PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030378
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 304aa    MW: 33395.2 Da    PI: 6.7076
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030378genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEdellv +++++G g+W++ ++  g+ R++k+c++rw +yl
      Lus10030378 14 RGPWTSEEDELLVTYIQKHGHGSWRSLPKLAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding43.57.1e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++++++l ++++  lG++ W++Ia+ ++ gRt++++k+ w+++l
      Lus10030378  67 RGPFSADDEKLVIQLHGILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129424.15965IPR017930Myb domain
SuperFamilySSF466895.24E-3011108IPR009057Homeodomain-like
SMARTSM007173.9E-141363IPR001005SANT/Myb domain
PfamPF002491.9E-161461IPR001005SANT/Myb domain
CDDcd001672.61E-111661No hitNo description
Gene3DG3DSA:1.10.10.605.8E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129418.50566116IPR017930Myb domain
SMARTSM007176.7E-1366114IPR001005SANT/Myb domain
PfamPF002497.1E-1367112IPR001005SANT/Myb domain
CDDcd001672.27E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGRQPCCDKK GLKRGPWTSE EDELLVTYIQ KHGHGSWRSL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF SADDEKLVIQ LHGILGNRWA AIAAQLPGRT DNEIKNLWNT HLKKRLVSMG  120
VDPQTHEPFD SPTSCSWLRN PAAAGTAAPS SSATRHMAQW ESARLEAEAR LSKATNPTTE  180
TPEADYFLRI WNSVVGESFR KLNKNGGAGG ERETGTSEES TSSSTKLAAN KSPKSENNAN  240
NTLALRSGDS SSCCGGDMED SSETALQLLL DFPMEHDMSF LEDSLSDNYG TGESYESYLI  300
CHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051856.11e-129Myb domain protein 17 isoform 1
TrEMBLA0A061E1591e-129A0A061E159_THECC; Myb domain protein 17 isoform 1
STRINGVIT_15s0046g03190.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-107myb domain protein 17